Gene capan_pan_p011898
Sequence ID | capan_pan_p011898 add to my list | ||
---|---|---|---|
Species | Capsicum annuum | ||
Alias | No gene alias | ||
Pangenome status | Dispensable (2/3) | ||
Length | 147aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 147 amino acids
>capan_pan_p011898_CAPAN MGIIDHISNMCEVTSTRKSKRKPLQTVEIKVKMDCDGCERRVTNAVSSMKGVKSVDVSRK QSRVTVSGYVEPKKVLKKVQNTGKKAEYWPYVEYNLVSYPYAPGAYDKKAPSGYVRAVPQ AFQIPNTPTEKFTSMFSDENPNACEIM
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP463678 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for capan_pan_p011898
Represented sequence(s):
Unrepresented genome(s):
CAPAN_Glabriusculum_Chiltepin_v2.0
CAPAN_Zunla_1_v2.0
CAPAN_CM334_v2.0
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AUR62014197-RA | orthology | 0.49 | 4 | - | - |
AUR62024872-RA | orthology | 0.66 | 5 | - | - |
AUR62030676-RA | orthology | 0.631 | 5 | - | - |
Bv2_043150_njdu.t1 | orthology | 0.589 | 4 | - | - |
Bv6_142690_rfcx.t1 | orthology | 0.847 | 5 | - | - |
Ca_9_830.1 | orthology | 0.528 | 7 | - | - |
Cc11_g08870 | orthology | 0.528 | 7 | - | - |
DCAR_007285 | orthology | 0.475 | 7 | 226 | 1.04e-77 |
DCAR_023613 | orthology | 0.52 | 7 | - | - |
DCAR_026769 | orthology | 0.49 | 7 | - | - |
HanXRQChr08g0212651 | orthology | 0.474 | 5 | 240 | 5.16e-83 |
Oeu036720.1 | orthology | 0.345 | 3 | - | - |
Oeu044351.1 | orthology | 0.328 | 3 | - | - |
PGSC0003DMP400010633 | orthology | 0.134 | 2 | - | - |
Solyc04g007630.1.1 | orthology | 0.127 | 2 | - | - |
capan_pan_p025493 | ultra-paralogy | 0.0598 | 0 | - | - |
capan_pan_p030603 | ultra-paralogy | 0.0105 | 0 | - | - |
ipotf_pan_p001332 | orthology | 0.489 | 3 | - | - |
ipotf_pan_p026205 | orthology | 0.494 | 3 | - | - |
ipotf_pan_p028506 | orthology | 0.35 | 3 | - | - |
itb04g14310.t1 | orthology | 0.467 | 3 | - | - |
itb07g07120.t1 | orthology | 0.343 | 3 | - | - |
itb14g01060.t2 | orthology | 0.494 | 3 | - | - |