Gene capan_pan_p012494


Sequence ID capan_pan_p012494  add to my list
Species Capsicum annuum
Alias No gene alias
Pangenome status Dispensable (2/3)
Length 166aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 166 amino acids

>capan_pan_p012494_CAPAN
MTGKILNSSLRGRYCLRGLRPPPVITLKLTVQMHCDACAQVLQKRIRKIQGVESVTTDLG
NNQVIVKGVVDPEKLASDVYKRTGKQAIVVKEEEVKKEEEKKEEEKKEKEEEEKKEEKGK
EEEDDKTTTDIKKSEYMYQKDYIFMEYANYPPQIFSDENPHACSIM



Multiple alignment used to build consensus sequence:



Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323
Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015545
Heavy metal transport/detoxification group1
3 GP040674 Unannotated cluster
4 GP070448 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121
Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163
Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for capan_pan_p012494



Represented sequence(s):
CAPAN_CM334_v2.0
CAPAN_Zunla_1_v2.0
Unrepresented genome(s):
CAPAN_Glabriusculum_Chiltepin_v2.0



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Ca_14_162.1 orthology 0.573 3 - -
Ca_32_762.1 orthology 0.637 3 - -
Ca_69_1.19 orthology 0.637 3 - -
Ca_78_26.1 orthology 0.573 3 - -
Ca_9_645.2 orthology 0.632 2 142 9.06e-43
Cc09_g00430 orthology 0.632 3 136 7.65e-41
Cg2g046420.1 orthology 0.704 9 - -
Cm145580.1 orthology 0.92 8 - -
Cm298860.1 orthology 0.71 8 106 4.35e-30
Cs2g01750.1 orthology 0.704 9 - -
DCAR_002239 orthology 0.58 5 - -
DCAR_030843 orthology 0.622 5 - -
FvH4_3g00420.1 orthology 0.668 9 - -
HanXRQChr16g0515801 orthology 0.723 5 - -
MELO3C008010.2.1 orthology 0.811 8 - -
Manes.09G082500.1 orthology 0.857 8 - -
Manes.S022000.1 orthology 0.631 8 - -
Oeu029318.1 orthology 0.505 4 - -
Oeu057024.1 orthology 0.543 4 - -
PGSC0003DMP400026383 orthology 0.221 2 192 4.14e-62
Solyc04g015030.2.1 orthology 0.229 2 187 3.69e-60
cajca.ICPL87119.gnm1.ann1.C.cajan_16695.1 orthology 0.679 7 - -
cajca.ICPL87119.gnm1.ann1.C.cajan_24624.1 orthology 0.616 7 - -
cicar_pan_p024449 orthology 0.636 6 - -
cucsa_pan_p011686 orthology 0.799 8 - -
maldo_pan_p012376 orthology 0.68 9 - -
maldo_pan_p020510 orthology 0.69 9 - -
medtr_pan_p010658 orthology 0.622 6 - -
phavu.G19833.gnm2.ann1.Phvul.003G086400.1 orthology 0.63 7 - -
phavu.G19833.gnm2.ann1.Phvul.006G139700.1 orthology 0.667 7 - -
soybn_pan_p008938 orthology 0.611 6 - -
soybn_pan_p009673 orthology 0.643 6 - -
soybn_pan_p024238 orthology 0.624 6 - -
thecc_pan_p018912 orthology 0.599 8 - -
vitvi_pan_p012828 orthology 0.659 7 - -