Gene capan_pan_p019823
Sequence ID | capan_pan_p019823 add to my list | ||
---|---|---|---|
Species | Capsicum annuum | ||
Alias | No gene alias | ||
Pangenome status | Core (3/3) | ||
Length | 167aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 167 amino acids
>capan_pan_p019823_CAPAN MRGFMCQPEVSTAVCLSCDSRSVVVPVAQRRMSMEEHAKLINKCSTRLGDVPRTLDSMPI SRRSRNVAAAAAVGSSVLTISKRDQENGSKIVPSLPLSDNSFQVVVMRVSLHCQGCAGKV KKHLSKMEGVTSFSIELDRQRVTVMGHVSPVGVLESISKVKRAEFWP
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP015837 | Unannotated cluster |
3 | GP040905 | Unannotated cluster |
4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for capan_pan_p019823
Represented sequence(s):
CAPAN_Zunla_1_v2.0
CAPAN_Glabriusculum_Chiltepin_v2.0
CAPAN_CM334_v2.0
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Bv8_190260_chqz.t1 | orthology | 0.83 | 3 | 115 | 2.83e-33 |
PGSC0003DMP400022303 | orthology | 0.0745 | 1 | 292 | 6.13e-103 |
Solyc01g105000.2.1 | orthology | 0.132 | 2 | 268 | 3.42e-93 |
capan_pan_p036114 | ultra-paralogy | 0.126 | 0 | - | - |
capan_pan_p041384 | ultra-paralogy | 0.117 | 0 | - | - |
evm_27.model.AmTr_v1.0_scaffold00010.206 | orthology | 0.841 | 4 | 139 | 7.89e-43 |