Gene capan_pan_p020108
Sequence ID | capan_pan_p020108 add to my list | ||
---|---|---|---|
Species | Capsicum annuum | ||
Alias | No gene alias | ||
Pangenome status | Core (3/3) | ||
Length | 154aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 154 amino acids
>capan_pan_p020108_CAPAN MGLRGTLEYISDMMRSSTHKSNRKKRLFHTVELKVRMDCDGCELKVKKALSSLSGVKSVE INRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAAAYDKKAPPGYVR RVDQNPTIGTVSRFEDNAYVTIFSDDNPNACSVM
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for capan_pan_p020108
Represented sequence(s):
CAPAN_Zunla_1_v2.0
CAPAN_CM334_v2.0
CAPAN_Glabriusculum_Chiltepin_v2.0
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
PGSC0003DMP400037825 | orthology | 0.151 | 2 | 258 | 5.82e-90 |
Solyc05g051820.2.1 | orthology | 0.144 | 2 | 263 | 6.05e-92 |
ipotf_pan_p006080 | orthology | 0.194 | 3 | 236 | 2.75e-81 |
itb12g00660.t1 | orthology | 0.181 | 3 | 239 | 1.8e-82 |