Gene capan_pan_p022048
| Sequence ID | capan_pan_p022048 add to my list | ||
|---|---|---|---|
| Species | Capsicum annuum | ||
| Alias | No gene alias | ||
| Pangenome status | Core (3/3) | ||
| Length | 150aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 150 amino acids
>capan_pan_p022048_CAPAN MKTITTGVFQQDLHGEEHAREVEQFIRQFKGVKDVNADYNTGKIMVTGSIANISRLRKIV ERTTNQKAELLTYEHKLDDGSSSGEDKKSKKAVRVRYGSSLFGCFKPKVVGRGHGRHPHH GHNHGHTSDSSSDHNDVHTCGIDFSASSEE
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP251367 | Unannotated cluster |
| 3 | GP358076 | Unannotated cluster |
| 4 | GP513603 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for capan_pan_p022048
Represented sequence(s):
CAPAN_Glabriusculum_Chiltepin_v2.0
CAPAN_Zunla_1_v2.0
CAPAN_CM334_v2.0
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| HanXRQChr12g0362781 | orthology | 1 | 3 | - | - |
| HanXRQChr12g0362811 | orthology | 1 | 3 | - | - |
| Oeu023492.2 | orthology | 1 | 4 | - | - |
| Oeu035900.1 | orthology | 1 | 4 | - | - |
| Oeu061138.1 | orthology | 1 | 4 | - | - |
| capan_pan_p031268 | ultra-paralogy | 0.418 | 0 | - | - |
| evm_27.model.AmTr_v1.0_scaffold00474.1 | orthology | 1 | 2 | - | - |
| vitvi_pan_p038581 | orthology | 1 | 1 | - | - |