Gene capan_pan_p022048
Sequence ID | capan_pan_p022048 add to my list | ||
---|---|---|---|
Species | Capsicum annuum | ||
Alias | No gene alias | ||
Pangenome status | Core (3/3) | ||
Length | 150aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 150 amino acids
>capan_pan_p022048_CAPAN MKTITTGVFQQDLHGEEHAREVEQFIRQFKGVKDVNADYNTGKIMVTGSIANISRLRKIV ERTTNQKAELLTYEHKLDDGSSSGEDKKSKKAVRVRYGSSLFGCFKPKVVGRGHGRHPHH GHNHGHTSDSSSDHNDVHTCGIDFSASSEE
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP251367 | Unannotated cluster |
3 | GP358076 | Unannotated cluster |
4 | GP513603 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for capan_pan_p022048
Represented sequence(s):
CAPAN_Glabriusculum_Chiltepin_v2.0
CAPAN_Zunla_1_v2.0
CAPAN_CM334_v2.0
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
HanXRQChr12g0362781 | orthology | 1 | 3 | - | - |
HanXRQChr12g0362811 | orthology | 1 | 3 | - | - |
Oeu023492.2 | orthology | 1 | 4 | - | - |
Oeu035900.1 | orthology | 1 | 4 | - | - |
Oeu061138.1 | orthology | 1 | 4 | - | - |
capan_pan_p031268 | ultra-paralogy | 0.418 | 0 | - | - |
evm_27.model.AmTr_v1.0_scaffold00474.1 | orthology | 1 | 2 | - | - |
vitvi_pan_p038581 | orthology | 1 | 1 | - | - |