Gene capan_pan_p025493
| Sequence ID | capan_pan_p025493 add to my list | ||
|---|---|---|---|
| Species | Capsicum annuum | ||
| Alias | No gene alias | ||
| Pangenome status | Core (3/3) | ||
| Length | 147aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 147 amino acids
>capan_pan_p025493_CAPAN MGIIDHISDMFEVTSTRKSKRKPLQTVEIKVKMDCDGCERRVTNAVSSIKGVKSVDVSRK QSRVTVSGYVEPKKVLKKVQNTGKKAEFWPYVEYNLVSYPYAPGAYDKKAPSGYVRDVPQ AFQTPNTPTERFTSMFSDENPNACAIM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP463678 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for capan_pan_p025493
Represented sequence(s):
CAPAN_Zunla_1_v2.0
CAPAN_CM334_v2.0
CAPAN_Glabriusculum_Chiltepin_v2.0
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AUR62014197-RA | orthology | 0.431 | 4 | 225 | 5.09e-77 |
| AUR62024872-RA | orthology | 0.601 | 5 | - | - |
| AUR62030676-RA | orthology | 0.573 | 5 | - | - |
| Bv2_043150_njdu.t1 | orthology | 0.53 | 4 | - | - |
| Bv6_142690_rfcx.t1 | orthology | 0.789 | 5 | - | - |
| Ca_9_830.1 | orthology | 0.469 | 7 | - | - |
| Cc11_g08870 | orthology | 0.469 | 7 | 222 | 5.2e-76 |
| DCAR_007285 | orthology | 0.416 | 7 | - | - |
| DCAR_023613 | orthology | 0.461 | 7 | - | - |
| DCAR_026769 | orthology | 0.431 | 7 | - | - |
| HanXRQChr08g0212651 | orthology | 0.415 | 5 | - | - |
| Oeu036720.1 | orthology | 0.286 | 3 | - | - |
| Oeu044351.1 | orthology | 0.269 | 3 | 241 | 1.75e-83 |
| PGSC0003DMP400010633 | orthology | 0.075 | 2 | 282 | 1.22e-99 |
| Solyc04g007630.1.1 | orthology | 0.0685 | 2 | 282 | 8.52e-100 |
| capan_pan_p011898 | ultra-paralogy | 0.0598 | 0 | - | - |
| capan_pan_p030603 | ultra-paralogy | 0.0692 | 0 | - | - |
| ipotf_pan_p001332 | orthology | 0.43 | 3 | - | - |
| ipotf_pan_p026205 | orthology | 0.435 | 3 | - | - |
| ipotf_pan_p028506 | orthology | 0.292 | 3 | 237 | 8.75e-81 |
| itb04g14310.t1 | orthology | 0.409 | 3 | - | - |
| itb07g07120.t1 | orthology | 0.284 | 3 | 239 | 1.07e-82 |
| itb14g01060.t2 | orthology | 0.435 | 3 | - | - |