Gene capan_pan_p030197
| Sequence ID | capan_pan_p030197 add to my list |
|---|---|
| Species | Capsicum annuum |
| Alias | No gene alias |
| Pangenome status | Specific (1/3) |
| Length | 145aa |
Length: 145 amino acids
>capan_pan_p030197_CAPAN GVYSVTIDSEEGTAKISGEVNPNLLLRALSRSGLGNHAELKWAKLKHLALSNGYMADGYG SYNHGYGSHNHGYGSYNYNSYSLGHGHSYNSLGGAFRRGRSLPECSYGYEGYNNYQYPFR GIGQDSYAQNYYSGALPPPRYVPAY
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP241299 | Unannotated cluster |
| 3 | GP344409 | Unannotated cluster |
| 4 | GP490191 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
Represented sequence(s):
Unrepresented genome(s):
CAPAN_Glabriusculum_Chiltepin_v2.0
CAPAN_CM334_v2.0
CAPAN_Zunla_1_v2.0
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Oeu049387.1 | orthology | 0.786 | 2 | 76.6 | 9.36e-19 |
| PGSC0003DMP400038366 | orthology | 0.234 | 2 | 195 | 5.04e-65 |
| Solyc07g065430.2.1 | orthology | 0.224 | 2 | - | - |
| ipotf_pan_p003402 | orthology | 1 | 3 | - | - |
| ipotf_pan_p021052 | orthology | 1 | 4 | - | - |
| itb02g23000.t1 | orthology | 1 | 4 | - | - |
| itb02g24290.t1 | orthology | 1 | 3 | - | - |