Gene capan_pan_p035797
| Sequence ID | capan_pan_p035797 add to my list |
|---|---|
| Species | Capsicum annuum |
| Alias | No gene alias |
| Pangenome status | Specific (1/3) |
| Length | 76aa |
Length: 76 amino acids
>capan_pan_p035797_CAPAN MATKYIVGSVLASFAVAYAFDVVIADKKVFGGNTPHTVANNEWWKETDKKFQAWPRTAGP PVVMNPISRQNYIVKS
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Unknown function duf1138 family
GP002478 |
Unknown function duf1138 family |
| 2 | GP018276 | Unannotated cluster |
| 3 | GP042981 | Unannotated cluster |
| 4 | GP072479 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Protein of unknown function DUF1138
IPR009515
|
Protein of unknown function DUF1138 | Family |
Figure 1: IPR domains for capan_pan_p035797
Represented sequence(s):
Unrepresented genome(s):
CAPAN_CM334_v2.0
CAPAN_Glabriusculum_Chiltepin_v2.0
CAPAN_Zunla_1_v2.0
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| ORGLA02G0204300.1 | orthology | 0.449 | 4 | - | - |
| ORGLA04G0145400.1 | orthology | 0.598 | 4 | - | - |
| PGSC0003DMP400040975 | orthology | 0.103 | 3 | 139 | 4.2e-45 |
| Solyc10g080190.1.1 | orthology | 0.0548 | 2 | 151 | 3.42e-50 |
| Sspon.04G0008560-1A | orthology | 0.343 | 3 | - | - |
| Sspon.04G0008560-2D | orthology | 0.358 | 4 | - | - |
| capan_pan_p022960 | ultra-paralogy | 0.194 | 0 | - | - |
| orysa_pan_p007341 | orthology | 0.449 | 4 | - | - |
| orysa_pan_p033623 | orthology | 0.582 | 4 | - | - |
| sorbi_pan_p029054 | orthology | 0.385 | 4 | 124 | 2.6e-39 |