Gene capan_pan_p041384


Sequence ID capan_pan_p041384  add to my list
Species Capsicum annuum
Alias No gene alias
Pangenome status Specific (1/3)
Length 118aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 118 amino acids

>capan_pan_p041384_CAPAN
MRGFMCHPEVSIAVCLSCDSRKFVVPVAQRRMSMEEHAKLINKCSSRLWDVAYTLDTVPI
SRRSNVVDSSVLTISKRDQENSFKIVPSLSFQVVVMRVSLHCQGCAGKVKKHLSKLEG




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP015837 Unannotated cluster
3 GP040905 Unannotated cluster
4 GP070656 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for capan_pan_p041384



Represented sequence(s):
CAPAN_Glabriusculum_Chiltepin_v2.0
Capang09g001687
Unrepresented genome(s):
CAPAN_CM334_v2.0
CAPAN_Zunla_1_v2.0


Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Bv8_190260_chqz.t1 orthology 0.946 3 - -
PGSC0003DMP400022303 orthology 0.19 1 - -
Solyc01g105000.2.1 orthology 0.248 2 - -
capan_pan_p019823 ultra-paralogy 0.117 0 - -
capan_pan_p036114 ultra-paralogy 0.0102 0 - -
evm_27.model.AmTr_v1.0_scaffold00010.206 orthology 0.957 4 - -