Gene cicar_pan_p008262
Sequence ID | cicar_pan_p008262 add to my list | ||
---|---|---|---|
Species | Cicer arietinum | ||
Alias | No gene alias | ||
Pangenome status | Core (2/2) | ||
Length | 156aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 156 amino acids
>cicar_pan_p008262_CICAR MGALDHISEFFDCSYSSSKLKKKRKQFQTVEVKVKMDCEGCERKVKKSVKGMKGVTQVEV ERKANKVTVTGYVEPSKVVARIAHRTGKRVELWPYVPYDVVAHPYAPGVYDKKAPSGYVR NANYDPNVSNLARASSTEVTYTTAFSDDNPTACVVM
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for cicar_pan_p008262
Represented sequence(s):
CICAR_CDC_Frontier_kabuli
CICAR_ICC_4958_desi
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
cajca.ICPL87119.gnm1.ann1.C.cajan_21306.1 | orthology | 0.151 | 3 | 273 | 5.51e-96 |
medtr_pan_p009659 | orthology | 0.0992 | 1 | 286 | 5.74e-101 |
phavu.G19833.gnm2.ann1.Phvul.011G035900.1 | orthology | 0.119 | 4 | 281 | 6.55e-99 |
soybn_pan_p021369 | orthology | 0.138 | 4 | 279 | 3.79e-98 |
soybn_pan_p037610 | orthology | 0.232 | 4 | - | - |
thecc_pan_p004464 | orthology | 0.381 | 3 | 224 | 4e-76 |