Gene cicar_pan_p008704
| Sequence ID | cicar_pan_p008704 add to my list | ||
|---|---|---|---|
| Species | Cicer arietinum | ||
| Alias | No gene alias | ||
| Pangenome status | Core (2/2) | ||
| Length | 244aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 244 amino acids
>cicar_pan_p008704_CICAR MKRIDIFCASQASTAICLSMDQASCSSSNTIQLGGRVIDRHNPIINDSRRKSTSKTLIAP CSSSSQPPIEPKKKISSSTSKLNNGTKVCEEKKKSEAEKVAEHVTIKRRLVKPLGDSITP FGSTRSLLSHTPIFDGSSHYHQIVGQHESNPASKLSRSSCPISGSSDQVVVLRVSLHCKG CEGKVRKHLSRMEGVTSFNIDFAAKKVTVIGDVTPFSVLESISKVKNAQFWPPVGSHIQE TKFK
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP015837 | Unannotated cluster |
| 3 | GP040905 | Unannotated cluster |
| 4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for cicar_pan_p008704
Represented sequence(s):
CICAR_CDC_Frontier_kabuli
CICAR_ICC_4958_desi
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT2G37390.1 | orthology | 1 | 4 | 154 | 4.39e-46 |
| AT3G53530.2 | orthology | 1 | 4 | - | - |
| MELO3C003095.2.1 | orthology | 0.926 | 4 | 163 | 1.13e-49 |
| brana_pan_p029929 | orthology | 1 | 6 | - | - |
| brana_pan_p030312 | orthology | 1 | 6 | - | - |
| brana_pan_p031480 | orthology | 1 | 5 | - | - |
| brana_pan_p036701 | orthology | 1 | 6 | 159 | 6.1e-48 |
| brana_pan_p041953 | orthology | 1 | 5 | - | - |
| braol_pan_p003859 | orthology | 1 | 5 | - | - |
| braol_pan_p015324 | orthology | 1 | 5 | - | - |
| braol_pan_p021666 | orthology | 1 | 5 | 167 | 9.46e-51 |
| braol_pan_p031578 | orthology | 1 | 5 | - | - |
| brarr_pan_p002630 | orthology | 1 | 6 | 169 | 1.18e-51 |
| brarr_pan_p008392 | orthology | 1 | 6 | - | - |
| brarr_pan_p026146 | orthology | 1 | 6 | - | - |
| brarr_pan_p039884 | orthology | 1 | 5 | - | - |
| cucsa_pan_p020833 | orthology | 0.946 | 4 | - | - |
| medtr_pan_p025678 | orthology | 0.213 | 1 | 301 | 1.11e-103 |