Gene cicar_pan_p021240
| Sequence ID | cicar_pan_p021240 add to my list |
|---|---|
| Species | Cicer arietinum |
| Alias | No gene alias |
| Pangenome status | Dispensable (1/2) |
| Length | 79aa |
Length: 79 amino acids
>cicar_pan_p021240_CICAR DGKVFERSKKKRPGVSPGDRSGGKAEQAFGKGKKQMKRDSKCGFGGKKGLKKQNTANTTN DFGGFNKKGADAGNKKRKR
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Unknown function duf1138 family
GP002478 |
Unknown function duf1138 family |
| 2 | GP018276 | Unannotated cluster |
| 3 | GP042981 | Unannotated cluster |
| 4 | GP075980 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Eukaryotic rRNA processing
IPR008610
|
Eukaryotic rRNA processing | Family |
Figure 1: IPR domains for cicar_pan_p021240
Represented sequence(s):
Unrepresented genome(s):
CICAR_ICC_4958_desi
CICAR_CDC_Frontier_kabuli
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| cicar_pan_p019499 | ultra-paralogy | 0.0509 | 0 | - | - |
| vitvi_pan_p006372 | orthology | 0.46 | 1 | - | - |