Gene cicar_pan_p021514


Sequence ID cicar_pan_p021514  add to my list
Species Cicer arietinum
Alias No gene alias
Pangenome status Dispensable (1/2)
Length 93aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 93 amino acids

>cicar_pan_p021514_CICAR
MGKLSRMLDTFCLSSGSNSCFCLNSIEFEDEFESKPLIASDKDDHKLRLKDVVSGKQTLA
FQLKPKMVILRVSMHCHGCARKIEKHISKLEGE




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP015837 Unannotated cluster
3 GP040905 Unannotated cluster
4 GP070656 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for cicar_pan_p021514



Represented sequence(s):
CICAR_CDC_Frontier_kabuli
cicar.CDCFrontier.gnm1.ann1.Ca_25248.1
Unrepresented genome(s):
CICAR_ICC_4958_desi


Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
MELO3C025323.2.1 orthology 0.479 3 109 6.61e-33
cucsa_pan_p016074 orthology 0.464 3 119 1.86e-36
medtr_pan_p025294 orthology 0.131 1 173 9.1e-58