Gene cicar_pan_p022227
| Sequence ID | cicar_pan_p022227 add to my list | ||
|---|---|---|---|
| Species | Cicer arietinum | ||
| Alias | No gene alias | ||
| Pangenome status | Dispensable (1/2) | ||
| Length | 128aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 128 amino acids
>cicar_pan_p022227_CICAR MMNLKTSNKKVMRRGFMCHSQSSTAVCMSTRESHTVVVPKRIEKSVSFDDTRLNINFAKY SKLVDSPNIMLKEKGQDYQAIEPRELHKTPTDNVFQVVVMRVAIHCQGCAGKVKKHLSKM EEYDHVTE
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP015837 | Unannotated cluster |
| 3 | GP040905 | Unannotated cluster |
| 4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for cicar_pan_p022227
Represented sequence(s):
Unrepresented genome(s):
CICAR_CDC_Frontier_kabuli
CICAR_ICC_4958_desi
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| FvH4_5g30890.1 | orthology | 0.78 | 5 | - | - |
| Oeu026170.2 | orthology | 0.862 | 3 | 89.7 | 5.52e-24 |
| cocnu_pan_p025689 | orthology | 0.69 | 4 | - | - |
| maldo_pan_p006499 | orthology | 0.972 | 5 | - | - |
| medtr_pan_p011208 | orthology | 0.197 | 1 | 183 | 2.11e-60 |
| medtr_pan_p033339 | orthology | 0.238 | 1 | - | - |