Gene cocnu_pan_p013975
Sequence ID | cocnu_pan_p013975 add to my list |
---|---|
Species | Cocos nucifera |
Alias | No gene alias |
Pangenome status | Core (2/2) |
Length | 223aa |
Length: 223 amino acids
>cocnu_pan_p013975_COCNU MKALSVKGVLETEIHPALPRVTVTGNIDARVLVKKLAKIGKPAEILPEETQKQQKEESNS DTRDKKAEMASEKEKASDIEKAKESNGTETSNFCCKDSNKKDEKGEVKSIDSKDPFLPAE LAKSLFPPIVTAVPQMNCAVAPSMVQNSAYLMASHAGVSYPVEPVAVLMPYYTMNAYSSP QPYCIRDHYYFEPPVHHSPPVQSQAMGFADYFNEDNTAGCNIM
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP023608 | Unannotated cluster |
3 | GP040483 | Unannotated cluster |
4 | GP080800 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
Represented sequence(s):
COCNU_CATD
COCNU_C3B02_v2.0
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Mba04_g17540.1 | orthology | 0.707 | 3 | 143 | 3.14e-42 |
Mba07_g02600.1 | orthology | 0.685 | 3 | - | - |
XP_008809958.1 | orthology | 0.187 | 1 | 271 | 2.97e-92 |
musac_pan_p001919 | orthology | 0.665 | 3 | - | - |
musac_pan_p015588 | orthology | 0.684 | 3 | 144 | 1.27e-42 |