Gene cocnu_pan_p016981
| Sequence ID | cocnu_pan_p016981 add to my list | ||
|---|---|---|---|
| Species | Cocos nucifera | ||
| Alias | No gene alias | ||
| Pangenome status | Core (2/2) | ||
| Length | 374aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 374 amino acids
>cocnu_pan_p016981_COCNU MVKGEDFKVLKMQTYVLKVNMHCHGCKEKVKKLLRKIEGVCSVSVDAEHQKVTVTGNVDS GTLIKKLARSGKRAELWSQKTTSQNHKTNQQKQAAAVARPMKDGHKNNKDKGKQGLVQSL QVFNNRHNKLSSLSSDEEDYDDDDEDDDLDDLPFLNMNQLNLLRQANNAAANAKKTGHGI SAGGNGNSGAGNKGGGNPSQNQIKNPNGSQQQDIDFSANSKIVNGVHLSGGNPHAGEGIR VNDINGMMMGLHGLGGNNGVGFQGNGFPGYSRFPSNGGVYGGHHQSPMMVNMQGYQAHPP SMMNNLRGLNNNMMMHPSTYMQPQMMYHRSPQIPPYTGYHNLYQSPYHPNNQSENDDYGV HLFSDENTRGCVVM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP023608 | Unannotated cluster |
| 3 | GP040483 | Unannotated cluster |
| 4 | GP070015 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for cocnu_pan_p016981
Represented sequence(s):
COCNU_CATD
COCNU_C3B02_v2.0
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Dr15259 | orthology | 0.667 | 4 | - | - |
| HORVU3Hr1G004420.1 | orthology | 0.769 | 4 | - | - |
| Mba02_g23430.1 | orthology | 0.675 | 3 | - | - |
| Mba03_g01140.1 | orthology | 0.544 | 3 | - | - |
| Mba10_g22160.1 | orthology | 0.594 | 3 | - | - |
| ORGLA01G0014900.1 | orthology | 0.758 | 4 | - | - |
| Sspon.03G0019370-1A | orthology | 0.874 | 5 | - | - |
| Sspon.03G0019370-2C | orthology | 0.834 | 5 | - | - |
| Sspon.03G0019370-3D | orthology | 0.819 | 5 | - | - |
| XP_010926063.1 | orthology | 0.066 | 1 | 559 | 2e-201 |
| XP_019707202.1 | orthology | 0.066 | 1 | - | - |
| bradi_pan_p041682 | orthology | 0.701 | 3 | - | - |
| maize_pan_p016355 | orthology | 0.912 | 5 | - | - |
| maize_pan_p016830 | orthology | 0.873 | 5 | - | - |
| musac_pan_p029655 | orthology | 0.655 | 3 | - | - |
| musac_pan_p029948 | orthology | 0.59 | 3 | - | - |
| musac_pan_p030748 | orthology | 0.527 | 2 | - | - |
| musac_pan_p032325 | orthology | 0.526 | 3 | - | - |
| orysa_pan_p014393 | orthology | 0.758 | 4 | - | - |
| sorbi_pan_p026568 | orthology | 0.813 | 4 | - | - |
| tritu_pan_p033683 | orthology | 0.748 | 4 | - | - |
| tritu_pan_p038784 | orthology | 0.738 | 4 | - | - |
| tritu_pan_p048092 | orthology | 0.749 | 4 | - | - |