Gene cocnu_pan_p018779
| Sequence ID | cocnu_pan_p018779 add to my list | ||
|---|---|---|---|
| Species | Cocos nucifera | ||
| Alias | No gene alias | ||
| Pangenome status | Core (2/2) | ||
| Length | 151aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 151 amino acids
>cocnu_pan_p018779_COCNU MGALDYLSNFCSVTSTRRALKRRKRKPMQTVEIKVKMDCDGCERRVKHAVKSLKGVTAVN VSRKQSRVTVTGHIEPNKVLKKVKSTGKVAEFWPYVPYNLVAYPYVAGAYDKKAPSGFVR NVAQAVPTPHAPEEKYVSLFSDENPNACSIM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP463678 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for cocnu_pan_p018779
Represented sequence(s):
| 1. | 2. | 3. | |
|---|---|---|---|
| 1. COCNU_HT001RO02_14PF06240.2 | 0.00 | -0.00 | -0.00 |
| 2. COCNU_HT001RO02_14PF06240.1 | -0.00 | 0.00 | -0.00 |
| 3. Cnu_11164-RA | -0.00 | -0.00 | 0.00 |
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| XP_026661299.1 | orthology | 0.111 | 1 | - | - |