Gene cocnu_pan_p026708
| Sequence ID | cocnu_pan_p026708 add to my list |
|---|---|
| Species | Cocos nucifera |
| Alias | No gene alias |
| Pangenome status | Dispensable (1/2) |
| Length | 59aa |
Length: 59 amino acids
>cocnu_pan_p026708_COCNU EEAKEQAKPKEEEEEKKEEKQEEKKEEAKPSPPPPVVLFVELHCVGCAKKIERSIRKCR
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
| 3 | GP126431 | Unannotated cluster |
| 4 | GP077890 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
Represented sequence(s):
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| ORGLA10G0100300.1 | orthology | 0.93 | 3 | - | - |
| orysa_pan_p015511 | orthology | 0.93 | 3 | - | - |
| orysa_pan_p051500 | orthology | 0.881 | 2 | - | - |
| tritu_pan_p053420 | orthology | 0.986 | 2 | - | - |