Gene cocnu_pan_p026834
Sequence ID | cocnu_pan_p026834 add to my list | ||
---|---|---|---|
Species | Cocos nucifera | ||
Alias | No gene alias | ||
Pangenome status | Dispensable (1/2) | ||
Length | 253aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 253 amino acids
>cocnu_pan_p026834_COCNU MQVYMHCEGCARKVKRSLKGFEGVEEVKTDCRIHKVVVKGRKAAEDPLKVVERVQKKTGR RPPVLAVLLKVHMHCEACALEIKKRILKMKGVQSVEADLKATQVTVTGVVDPAKLVEYIY KRTGKHAVVVKQEPVEKKSDDEKKAADGKDGGKDEKKADAGSEKAEGEKKDEKEGGGEEK DKDKEDNGGAAEDAAAAAGGAAKVVDLMKNEFYYYYPRYGVGYAYPPHPYLPQAYPYPPQ IFSDENPNACTVM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP040674 | Unannotated cluster |
4 | GP070448 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for cocnu_pan_p026834
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Mba06_g07140.1 | orthology | 0.273 | 3 | - | - |
Mba09_g01180.1 | orthology | 0.36 | 3 | - | - |
XP_010905511.1 | orthology | 0.0684 | 1 | 276 | 2.72e-92 |
musac_pan_p001323 | orthology | 0.3 | 3 | - | - |
musac_pan_p006095 | orthology | 0.276 | 3 | - | - |
musac_pan_p033691 | orthology | 0.571 | 2 | - | - |