Gene cocnu_pan_p027064


Sequence ID cocnu_pan_p027064  add to my list
Species Cocos nucifera
Alias No gene alias
Pangenome status Dispensable (1/2)
Length 151aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 151 amino acids

>cocnu_pan_p027064_COCNU
MHCEGCARKVERSLRRFEGVEDVKIDSRSRTVVVKGKGADPIKICERIQKKTGKKVELIS
PIPKPPEEEKKEEPPQEEKKEEPKAITVILKVRMHCDACAQVLQRRIKKMDGVESVVTDL
PKDQVIVKGIIDPVKLVENVYRRTRKQASIV




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015545		 Heavy metal transport/detoxification group1
3 GP040674 Unannotated cluster
4 GP070448 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for cocnu_pan_p027064



Represented sequence(s):
COCNU_CATD
Cnu_25353-RA
Unrepresented genome(s):
COCNU_C3B02_v2.0


Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Dr07989 orthology 0.456 5 186 1.37e-59
Mba01_g01930.1 orthology 0.297 5 174 3.9e-56
ORGLA10G0044600.1 orthology 0.497 4 165 6.88e-52
XP_008785647.1 orthology 0.0945 2 251 2.09e-85
XP_010939247.1 orthology 0.0719 1 259 1.42e-88
musac_pan_p010117 orthology 0.278 5 211 3.93e-70
orysa_pan_p012537 orthology 0.497 4 165 1.03e-51