Gene cocnu_pan_p027064
Sequence ID | cocnu_pan_p027064 add to my list | ||
---|---|---|---|
Species | Cocos nucifera | ||
Alias | No gene alias | ||
Pangenome status | Dispensable (1/2) | ||
Length | 151aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 151 amino acids
>cocnu_pan_p027064_COCNU MHCEGCARKVERSLRRFEGVEDVKIDSRSRTVVVKGKGADPIKICERIQKKTGKKVELIS PIPKPPEEEKKEEPPQEEKKEEPKAITVILKVRMHCDACAQVLQRRIKKMDGVESVVTDL PKDQVIVKGIIDPVKLVENVYRRTRKQASIV
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP040674 | Unannotated cluster |
4 | GP070448 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for cocnu_pan_p027064
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Dr07989 | orthology | 0.456 | 5 | 186 | 1.37e-59 |
Mba01_g01930.1 | orthology | 0.297 | 5 | 174 | 3.9e-56 |
ORGLA10G0044600.1 | orthology | 0.497 | 4 | 165 | 6.88e-52 |
XP_008785647.1 | orthology | 0.0945 | 2 | 251 | 2.09e-85 |
XP_010939247.1 | orthology | 0.0719 | 1 | 259 | 1.42e-88 |
musac_pan_p010117 | orthology | 0.278 | 5 | 211 | 3.93e-70 |
orysa_pan_p012537 | orthology | 0.497 | 4 | 165 | 1.03e-51 |