Gene cocnu_pan_p029011
Sequence ID | cocnu_pan_p029011 add to my list |
---|---|
Species | Cocos nucifera |
Alias | No gene alias |
Pangenome status | Dispensable (1/2) |
Length | 87aa |
Length: 87 amino acids
>cocnu_pan_p029011_COCNU MGKGLISEDLFLFWTHSRVWSFCLVKRMGKEDSINFLKARGKVTVSGNVDPAILLKKLNK AGKHAELWGSKGGKNDHLSDQLQKAAE
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP023608 | Unannotated cluster |
3 | GP040483 | Unannotated cluster |
4 | GP070015 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Mba08_g00430.1 | orthology | 0.497 | 3 | - | - |
Mba08_g07910.1 | orthology | 0.576 | 3 | - | - |
Mba11_g17720.1 | orthology | 0.63 | 3 | - | - |
XP_010907378.1 | orthology | 0.116 | 1 | - | - |
cocnu_pan_p028798 | ultra-paralogy | 0.0104 | 0 | - | - |
musac_pan_p000711 | orthology | 0.481 | 3 | - | - |
musac_pan_p017513 | orthology | 1 | 2 | - | - |
musac_pan_p017535 | orthology | 0.629 | 3 | - | - |
musac_pan_p026837 | orthology | 0.587 | 3 | - | - |