Gene cocnu_pan_p034578


Sequence ID cocnu_pan_p034578  add to my list
Species Cocos nucifera
Alias No gene alias
Pangenome status Dispensable (1/2)
Length 125aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 125 amino acids

>cocnu_pan_p034578_COCNU
MDCEGCEKRIRKAISKLEGVDTVEIDMDKQKVTVTGYVDQRKVLKAARRTGRKAEFWPYP
YDSQYHPFAIQYLEDSTYLSTYNYYRHGYNSSVYGYFPDPAYSTILDDEVVAVFNDDNVH
ACMIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP078604 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for cocnu_pan_p034578



Represented sequence(s):
COCNU_CATD
Cnu_16085-RA
Unrepresented genome(s):
COCNU_C3B02_v2.0


Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Dr00501 orthology 0.246 2 228 3.47e-78
HORVU6Hr1G066220.1 orthology 0.758 5 161 8.32e-52
Mba02_g11510.1 orthology 0.301 4 181 1.2e-60
Sspon.04G0006170-1A orthology 0.908 5 - -
Sspon.04G0023540-1B orthology 1 5 158 8.25e-49
XP_008783549.1 orthology 0.139 2 238 1.3e-82
XP_010934033.1 orthology 0.0796 2 241 1.18e-83
maize_pan_p014734 orthology 0.893 5 147 4.08e-47
musac_pan_p001552 orthology 0.251 4 218 1.71e-74
orysa_pan_p046445 orthology 0.541 4 193 1.32e-64
sorbi_pan_p005993 orthology 0.615 4 187 2.03e-62
tritu_pan_p005371 orthology 0.554 5 - -
tritu_pan_p026136 orthology 0.559 5 188 1.1e-62