Gene cucsa_pan_p011686
| Sequence ID | cucsa_pan_p011686 add to my list | ||
|---|---|---|---|
| Species | Cucumis sativus | ||
| Alias | No gene alias | ||
| Pangenome status | Core (3/3) | ||
| Length | 300aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 300 amino acids
>cucsa_pan_p011686_CUCSA MGEEIKKNDDGGDQKKEETKQQEKKEPTESATPPPPPTTEDEQKKQENKKNEEEPPQDIV LKVDMHCEACARKVARALKGFQGVENVTTDSRAGKVVVKGKGADPKKVCERLQKKSGRKV ELISPLPKPPEEQPKEEDKQPKEEKKEEVPPPPAVVTVVLNVQMHCEACAQVLRKRIRKF KGVESVETDLANNQVIVKGVMDPARLVDHVSKRSRRPASIVVKEEEKKEGEKKEEEKPAG EEKAEEKKETQEEEKEEDDKKFDIKRLEYYWPSTKSYTEYYAYVPERLFSDENPNACSIM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
| 3 | GP040674 | Unannotated cluster |
| 4 | GP070448 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for cucsa_pan_p011686
Represented sequence(s):
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Ca_14_162.1 | orthology | 0.685 | 8 | 219 | 2.49e-70 |
| Ca_32_762.1 | orthology | 0.749 | 8 | - | - |
| Ca_69_1.19 | orthology | 0.749 | 8 | - | - |
| Ca_78_26.1 | orthology | 0.685 | 8 | - | - |
| Ca_9_645.2 | orthology | 0.744 | 7 | - | - |
| Cc09_g00430 | orthology | 0.744 | 8 | 171 | 9.13e-53 |
| Cg2g046420.1 | orthology | 0.485 | 4 | 214 | 1.72e-69 |
| Cm145580.1 | orthology | 0.702 | 3 | - | - |
| Cm298860.1 | orthology | 0.491 | 3 | - | - |
| Cs2g01750.1 | orthology | 0.485 | 4 | 226 | 2.47e-73 |
| DCAR_002239 | orthology | 0.64 | 8 | - | - |
| DCAR_030843 | orthology | 0.682 | 8 | 223 | 6.89e-72 |
| FvH4_3g00420.1 | orthology | 0.5 | 6 | 242 | 1.01e-79 |
| HanXRQChr16g0515801 | orthology | 0.783 | 8 | 192 | 5.95e-60 |
| MELO3C008010.2.1 | orthology | 0.0276 | 1 | 326 | 3.14e-112 |
| Manes.09G082500.1 | orthology | 0.639 | 3 | 193 | 2.08e-60 |
| Manes.S022000.1 | orthology | 0.412 | 3 | - | - |
| Oeu029318.1 | orthology | 0.565 | 7 | 211 | 4.52e-68 |
| Oeu057024.1 | orthology | 0.604 | 7 | - | - |
| PGSC0003DMP400023518 | orthology | 0.897 | 10 | - | - |
| PGSC0003DMP400026383 | orthology | 0.662 | 9 | 221 | 2.38e-71 |
| Solyc04g015030.2.1 | orthology | 0.67 | 9 | 224 | 1.43e-72 |
| Solyc11g012690.1.1 | orthology | 0.946 | 10 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_16695.1 | orthology | 0.559 | 6 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_24624.1 | orthology | 0.495 | 6 | 230 | 1.74e-75 |
| capan_pan_p012494 | orthology | 0.799 | 8 | - | - |
| capan_pan_p018045 | orthology | 0.912 | 9 | - | - |
| cicar_pan_p024449 | orthology | 0.515 | 5 | 227 | 6.67e-74 |
| ipotf_pan_p000797 | orthology | 0.684 | 9 | 204 | 6.71e-65 |
| itb01g10210.t2 | orthology | 0.69 | 9 | 203 | 2.05e-64 |
| maldo_pan_p012376 | orthology | 0.512 | 6 | 243 | 1.17e-79 |
| maldo_pan_p020510 | orthology | 0.522 | 6 | - | - |
| medtr_pan_p010658 | orthology | 0.501 | 5 | 223 | 3.01e-72 |
| phavu.G19833.gnm2.ann1.Phvul.003G086400.1 | orthology | 0.509 | 6 | 233 | 2.33e-76 |
| phavu.G19833.gnm2.ann1.Phvul.006G139700.1 | orthology | 0.546 | 6 | - | - |
| soybn_pan_p008938 | orthology | 0.49 | 5 | 241 | 4.62e-79 |
| soybn_pan_p009673 | orthology | 0.522 | 5 | - | - |
| soybn_pan_p024238 | orthology | 0.503 | 5 | - | - |
| thecc_pan_p018912 | orthology | 0.431 | 5 | 219 | 1.27e-70 |
| vitvi_pan_p012828 | orthology | 0.49 | 4 | 238 | 6.75e-78 |