Gene cucsa_pan_p011897
Sequence ID | cucsa_pan_p011897 add to my list | ||
---|---|---|---|
Species | Cucumis sativus | ||
Alias | No gene alias | ||
Pangenome status | Dispensable (2/3) | ||
Length | 97aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 97 amino acids
>cucsa_pan_p011897_CUCSA MEVVDLKVCLHCKSCENSVRKTLCKIKGVKCVETNRALNKITVLGYMDRKIVIKEVRKTG RKAEVLSSSSYRHPSTPRLKSRRATTAFKCIMPSCFL
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for cucsa_pan_p011897
Represented sequence(s):
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Cc06_g23640 | orthology | 1 | 3 | 90.5 | 1.91e-25 |
Cg4g020120.1 | orthology | 0.661 | 2 | 97.8 | 6.69e-28 |
Cm053960.1 | orthology | 0.726 | 1 | 101 | 2.26e-28 |
Cs4g04870.1 | orthology | 0.661 | 2 | 101 | 1.72e-29 |
thecc_pan_p023685 | orthology | 0.816 | 2 | 93.6 | 1.48e-26 |
vitvi_pan_p042652 | orthology | 1 | 4 | - | - |