Gene cucsa_pan_p017723
| Sequence ID | cucsa_pan_p017723 add to my list | ||
|---|---|---|---|
| Species | Cucumis sativus | ||
| Alias | No gene alias | ||
| Pangenome status | Core (3/3) | ||
| Length | 333aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 333 amino acids
>cucsa_pan_p017723_CUCSA MGEEEKKPDEKTVSAEEMAVQKPPPEDVNAKEKKDESKPSEKEETKTEESKDGKEPTKEQ APPPPPPEIVLKVYMHCEGCARKVRRCLRGFEGVEDVITDCKTHKVVVKGEKADPLKVLD RVQRKSHRQVELLSPIPKPPEPEELKPEEKEKPKPEEKKEEPQVVTVVLGVHMHCEACAQ EIKKRILRMKGVDAVEADLKASQVSVTGVFDPPKLVDYVYKRTGKHAVIVKTDPEKKQKE TEAKETKEEKANEESGKEKKGDEGGENKESNKEAEGGGGEAKSAVEVTPEETILVELKKN EYYQHYPQRYAMEMYAYPPQIFSDENPNACSVM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
| 3 | GP040674 | Unannotated cluster |
| 4 | GP070448 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for cucsa_pan_p017723
Represented sequence(s):
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT5G50740.3 | orthology | 0.466 | 3 | 240 | 4.53e-78 |
| MELO3C002372.2.1 | orthology | 0.0177 | 1 | 427 | 5.5e-151 |
| brana_pan_p008102 | orthology | 0.468 | 5 | 259 | 1.49e-85 |
| braol_pan_p032028 | orthology | 0.468 | 5 | 259 | 1.99e-85 |
| brarr_pan_p007939 | orthology | 0.476 | 4 | 264 | 6.3e-88 |