Gene cucsa_pan_p017978
Sequence ID | cucsa_pan_p017978 add to my list | ||
---|---|---|---|
Species | Cucumis sativus | ||
Alias | No gene alias | ||
Pangenome status | Core (3/3) | ||
Length | 269aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 269 amino acids
>cucsa_pan_p017978_CUCSA MGEKKNDDTTTAVFKIDIHCEGCANKLRRSVRQIPGVSRVRADWEANKLTVIGKFDPAKL RDYLADKETKKIDIVSSESKKEKESTKKQDDEKPDKKTEDKKQPKDKEIPVTTATLKVEL HCQGCIEKIYKVVSRTKGVEDMAIERQKDLVMVKGKMDVKALIENLEEKLKRKVAVVVPK KDKDEGAKGGDGGDKNKTGGEVAQGGGAMEGNRLDYVAVPVPGYGYGYGYGYGYGNGNGG FVGQHMPPAQPLISPQMFSDENPNACSVM
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP040674 | Unannotated cluster |
4 | GP467000 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for cucsa_pan_p017978
Represented sequence(s):
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
MELO3C026908.2.1 | orthology | 0.0668 | 1 | 399 | 7.65e-141 |