Gene cucsa_pan_p020833
| Sequence ID | cucsa_pan_p020833 add to my list | ||
|---|---|---|---|
| Species | Cucumis sativus | ||
| Alias | No gene alias | ||
| Pangenome status | Core (3/3) | ||
| Length | 281aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 281 amino acids
>cucsa_pan_p020833_CUCSA MKTIDFFCASQASTAVDQPSSSPAGRFIDRHNPIIADARRSNVTSRTTNFPNPPCSSQYS PINPLPYHQLHAAAAAASPNVAGDQIRPSGVSGNHKDLKMKKKKKKSSSIITTDFVRWSC AKPSDLATPPGSMRYLLNDKSVPDGSMDRIPTPIPINKNQPSSNPQDPHHSKPTPQISSQ DDSNKSPPSNQVVVLRVSLHCRGCEGKLRKHLSKMEGVNSFNIDFAAKKVTIMGNITPQG MLESVSKVKNAQFWPYADPTPTPTPNPNLNQNHHPNVLKKT
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP015837 | Unannotated cluster |
| 3 | GP040905 | Unannotated cluster |
| 4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for cucsa_pan_p020833
Represented sequence(s):
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT2G37390.1 | orthology | 1 | 3 | - | - |
| AT3G53530.2 | orthology | 1 | 3 | 135 | 1.94e-38 |
| MELO3C003095.2.1 | orthology | 0.0692 | 1 | 437 | 1.1e-156 |
| brana_pan_p029929 | orthology | 1 | 5 | - | - |
| brana_pan_p030312 | orthology | 1 | 5 | - | - |
| brana_pan_p031480 | orthology | 1 | 4 | - | - |
| brana_pan_p036701 | orthology | 1 | 5 | 137 | 1.12e-38 |
| brana_pan_p041953 | orthology | 1 | 4 | - | - |
| braol_pan_p003859 | orthology | 1 | 4 | - | - |
| braol_pan_p015324 | orthology | 1 | 4 | - | - |
| braol_pan_p021666 | orthology | 1 | 4 | - | - |
| braol_pan_p031578 | orthology | 1 | 4 | 136 | 2.22e-38 |
| brarr_pan_p002630 | orthology | 1 | 5 | 139 | 7.94e-40 |
| brarr_pan_p008392 | orthology | 1 | 5 | - | - |
| brarr_pan_p026146 | orthology | 1 | 5 | - | - |
| brarr_pan_p039884 | orthology | 1 | 4 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_09762.1 | orthology | 0.929 | 4 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_37472.1 | orthology | 0.884 | 5 | 195 | 2.58e-61 |
| cicar_pan_p008704 | orthology | 0.946 | 4 | - | - |
| cicar_pan_p017889 | orthology | 0.969 | 4 | 168 | 1.17e-50 |
| medtr_pan_p001385 | orthology | 0.952 | 4 | - | - |
| medtr_pan_p025678 | orthology | 0.968 | 4 | 169 | 2.77e-51 |
| phavu.G19833.gnm2.ann1.Phvul.001G171400.1 | orthology | 0.941 | 5 | - | - |
| phavu.G19833.gnm2.ann1.Phvul.L001741.1 | orthology | 0.954 | 5 | 187 | 1.17e-58 |
| soybn_pan_p015281 | orthology | 0.933 | 5 | - | - |
| soybn_pan_p025035 | orthology | 0.945 | 5 | - | - |
| soybn_pan_p025142 | orthology | 0.85 | 4 | 201 | 9.28e-64 |