Gene cucsa_pan_p020835
| Sequence ID | cucsa_pan_p020835 add to my list | ||
|---|---|---|---|
| Species | Cucumis sativus | ||
| Alias | No gene alias | ||
| Pangenome status | Core (3/3) | ||
| Length | 149aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 149 amino acids
>cucsa_pan_p020835_CUCSA MGIFDSVSDLISDYVATSRQRKKKPLQTVEIKVKMDCDGCERRVKNAVTKMKGAKTVEVN RKQSKVTVTGFVEANRVLKKVRRTGKRAELWPYVPYNVVAYPYVTQAYDKRAPAGFVKNA VQAIPSPNAVDEKLTTMFSDDNPNGCSVM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP463678 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for cucsa_pan_p020835
Represented sequence(s):
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Cg2g033960.1 | orthology | 0.609 | 6 | - | - |
| Cg2g033970.1 | orthology | 0.478 | 5 | 226 | 1.02e-77 |
| Cm053240.1 | orthology | 0.609 | 6 | - | - |
| Cm053250.1 | orthology | 0.492 | 6 | 224 | 1.41e-76 |
| Cs2g13790.1 | orthology | 0.485 | 6 | 226 | 1.11e-77 |
| Cs2g13800.1 | orthology | 0.617 | 5 | - | - |
| MELO3C012307.2.1 | orthology | 0.0206 | 1 | 293 | 2.93e-104 |
| Manes.15G126400.1 | orthology | 0.397 | 3 | 236 | 2.16e-81 |
| Manes.17G075300.1 | orthology | 0.451 | 3 | - | - |
| thecc_pan_p004875 | orthology | 0.384 | 4 | 234 | 1.04e-80 |