Gene cucsa_pan_p021160
| Sequence ID | cucsa_pan_p021160 add to my list | ||
|---|---|---|---|
| Species | Cucumis sativus | ||
| Alias | No gene alias | ||
| Pangenome status | Specific (1/3) | ||
| Length | 59aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 59 amino acids
>cucsa_pan_p021160_CUCSA MGKHRKLIRRKKMSKNPSHFLKVETRVLKVHVDCQGCLQRVRKLLNRIEGLFVTRVKHI
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP023608 | Unannotated cluster |
| 3 | GP040483 | Unannotated cluster |
| 4 | GP070015 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for cucsa_pan_p021160
Represented sequence(s):
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| MELO3C020302.2.1 | orthology | 0.3 | 1 | - | - |
| cucsa_pan_p016069 | ultra-paralogy | 0.226 | 0 | - | - |
| ipotf_pan_p018045 | orthology | 1 | 4 | - | - |
| ipotf_pan_p024342 | orthology | 1 | 3 | - | - |
| ipotf_pan_p028234 | orthology | 1 | 4 | - | - |
| itb02g05430.t1 | orthology | 1 | 4 | - | - |
| itb02g05440.t1 | orthology | 1 | 4 | - | - |
| medtr_pan_p024217 | orthology | 1 | 3 | - | - |
| soybn_pan_p037062 | orthology | 1 | 3 | - | - |
| soybn_pan_p040391 | orthology | 1 | 3 | - | - |
| vitvi_pan_p017756 | orthology | 1 | 4 | - | - |
| vitvi_pan_p040146 | orthology | 1 | 4 | - | - |