Gene evm_27.model.AmTr_v1.0_scaffold00010.206
Sequence ID | evm_27.model.AmTr_v1.0_scaffold00010.206 add to my list | ||
---|---|---|---|
Species | Amborella trichopoda | ||
Alias | No gene alias | ||
Length | 160aa | ||
Gene Ontology |
![]()
|
Length: 160 amino acids
>evm_27.model.AmTr_v1.0_scaffold00010.206_AMBTC MAGFLCRTPASTSICMASDHRRVLEPEKSAKLLDVKYSRLVESKRFSSIPSKTPPPKNEG LRRVKSERSDRKMPEKILRLPQPSDSKRVFQVVVMRVSLHCRGCAGKVKKHISKMEGVTS FSIDLETKRVTVMGHISPLGVLESVSKVKRAELWSAAATV
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP015837 | Unannotated cluster |
3 | GP040905 | Unannotated cluster |
4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for evm_27.model.AmTr_v1.0_scaffold00010.206
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Bv8_190260_chqz.t1 | orthology | 0.837 | 2 | 123.6 | 1e-28 |
PGSC0003DMP400022303 | orthology | 0.795 | 4 | 136.3 | 1.8e-32 |
Solyc01g105000.2.1 | orthology | 0.81 | 3 | 134.4 | 6.6e-32 |
capan_pan_p019823 | orthology | 0.841 | 4 | 136 | 1.93e-41 |
capan_pan_p036114 | orthology | 0.966 | 4 | - | - |
capan_pan_p041384 | orthology | 0.957 | 4 | - | - |