Gene evm_27.model.AmTr_v1.0_scaffold00016.303


Sequence ID evm_27.model.AmTr_v1.0_scaffold00016.303  add to my list
Species Amborella trichopoda
Alias No gene alias
Length 308aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 308 amino acids

>evm_27.model.AmTr_v1.0_scaffold00016.303_AMBTC
MGRGRYYQNFVKRIAALTAVGNIEIVELKVFIHCEGCNKKVKKLLSTIEGVYRTTVDPNL
HKVSVEVLGSVNPDTLVKKLVRNGKKAELWQGKKPAKEEKKEQKAEENGKEKAKDNTAPA
KKSGNEGNNKEEKKTVKEDKNEFTEQAIEESPSKKGNKKSQKDGDHGEGTSENSSSNSGN
PDPPAAGNNFGHVVPAVMPPPVSYRVENYYPQPPPPPVVYYGRDVYGPPYTTPTPYGLPH
TTPAPQVMYHTHYAATQPTAYYTGYAGPAYAYDRDRYYGPSSASYTQVVHEDVGDYFSDE
NANSCSIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP023608 Unannotated cluster
3 GP040483 Unannotated cluster
4 GP070015 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for evm_27.model.AmTr_v1.0_scaffold00016.303



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
AUR62008611-RA orthology 1 3 - -
Bv7_164120_fciq.t1 orthology 1 3 - -
HORVU1Hr1G058350.3 orthology 1 2 - -
HORVU2Hr1G019950.2 orthology 1 2 - -
HORVU3Hr1G097770.1 orthology 1 2 - -
HORVU4Hr1G046610.1 orthology 1 2 - -
HORVU7Hr1G118340.7 orthology 1 2 - -
ORGLA01G0367200.1 orthology 1 2 - -
ORGLA03G0163700.1 orthology 1 3 - -
ORGLA05G0119100.1 orthology 1 2 - -
ORGLA07G0202400.1 orthology 1 2 - -
ORGLA07G0259600.1 orthology 1 3 - -
Sspon.01G0009480-1A orthology 1 3 - -
Sspon.01G0009680-1A orthology 1 3 - -
Sspon.01G0009680-1P orthology 1 3 - -
Sspon.01G0009680-2D orthology 1 3 - -
Sspon.01G0009680-2P orthology 1 3 - -
Sspon.02G0001280-1A orthology 1 3 - -
Sspon.02G0001280-1P orthology 1 3 - -
Sspon.02G0001280-2C orthology 1 3 - -
Sspon.02G0001280-3D orthology 1 3 - -
Sspon.03G0027420-1B orthology 1 3 - -
Sspon.03G0027420-2C orthology 1 3 - -
Sspon.03G0027420-3D orthology 1 3 - -
bradi_pan_p028125 orthology 1 1 - -
bradi_pan_p029431 orthology 1 1 - -
bradi_pan_p033443 orthology 1 1 - -
bradi_pan_p044859 orthology 1 1 - -
maize_pan_p014480 orthology 1 1 - -
maize_pan_p022437 orthology 1 2 - -
maize_pan_p026502 orthology 1 1 - -
maize_pan_p027253 orthology 1 3 - -
maize_pan_p029987 orthology 1 2 - -
maize_pan_p036961 orthology 1 2 - -
maize_pan_p037490 orthology 1 2 - -
orysa_pan_p007866 orthology 1 2 - -
orysa_pan_p021264 orthology 1 2 - -
orysa_pan_p025850 orthology 1 2 - -
orysa_pan_p035995 orthology 1 2 - -
sorbi_pan_p003399 orthology 1 3 - -
sorbi_pan_p005326 orthology 1 3 - -
sorbi_pan_p013497 orthology 1 2 - -
tritu_pan_p002683 orthology 1 2 - -
tritu_pan_p003230 orthology 1 2 - -
tritu_pan_p006335 orthology 1 2 - -
tritu_pan_p016524 orthology 1 2 - -
tritu_pan_p039713 orthology 1 1 - -
tritu_pan_p044639 orthology 1 2 - -
tritu_pan_p045179 orthology 1 2 - -
tritu_pan_p045822 orthology 1 1 - -
tritu_pan_p046304 orthology 1 2 - -
tritu_pan_p050175 orthology 1 2 - -
tritu_pan_p051083 orthology 1 2 - -