Gene ipotf_pan_p001332
| Sequence ID | ipotf_pan_p001332 add to my list | ||
|---|---|---|---|
| Species | Ipomoea trifida | ||
| Alias | No gene alias | ||
| Pangenome status | Core (2/2) | ||
| Length | 146aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 146 amino acids
>ipotf_pan_p001332_IPOTF MGFVDHLSDKFEVTSTRKSSRKAMQTVEIMVEMDCDGCEKRVRKAVSSIKGAESVEIDRN ESRVTVKGYVEPDKVLRKVQRTGKSAEFWPYVRYDLVAKPYAHEAYDEVAPQGYVRNVPQ ALLPNPTTERFTTMFSDENPNACFIM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for ipotf_pan_p001332
Represented sequence(s):
IPOTF_NSP306
IPOTF_Y22
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AUR62014197-RA | orthology | 0.711 | 4 | - | - |
| AUR62024872-RA | orthology | 0.881 | 5 | - | - |
| AUR62030676-RA | orthology | 0.852 | 5 | - | - |
| Bv2_043150_njdu.t1 | orthology | 0.81 | 4 | - | - |
| Bv6_142690_rfcx.t1 | orthology | 1 | 5 | - | - |
| Ca_9_830.1 | orthology | 0.749 | 7 | - | - |
| Cc11_g08870 | orthology | 0.749 | 7 | - | - |
| DCAR_007285 | orthology | 0.696 | 7 | - | - |
| DCAR_023613 | orthology | 0.741 | 7 | - | - |
| DCAR_026769 | orthology | 0.711 | 7 | - | - |
| HanXRQChr08g0212651 | orthology | 0.695 | 5 | - | - |
| Oeu036720.1 | orthology | 0.566 | 3 | - | - |
| Oeu044351.1 | orthology | 0.549 | 3 | - | - |
| PGSC0003DMP400010633 | orthology | 0.489 | 4 | - | - |
| Solyc04g007630.1.1 | orthology | 0.483 | 4 | - | - |
| capan_pan_p011898 | orthology | 0.489 | 3 | - | - |
| capan_pan_p025493 | orthology | 0.43 | 3 | - | - |
| capan_pan_p030603 | orthology | 0.498 | 3 | - | - |
| itb04g14310.t1 | orthology | 0.0227 | 1 | 290 | 1.09e-102 |