Gene ipotf_pan_p001332
Sequence ID | ipotf_pan_p001332 add to my list | ||
---|---|---|---|
Species | Ipomoea trifida | ||
Alias | No gene alias | ||
Pangenome status | Core (2/2) | ||
Length | 146aa | ||
Gene Ontology |
![]()
|
Length: 146 amino acids
>ipotf_pan_p001332_IPOTF MGFVDHLSDKFEVTSTRKSSRKAMQTVEIMVEMDCDGCEKRVRKAVSSIKGAESVEIDRN ESRVTVKGYVEPDKVLRKVQRTGKSAEFWPYVRYDLVAKPYAHEAYDEVAPQGYVRNVPQ ALLPNPTTERFTTMFSDENPNACFIM
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for ipotf_pan_p001332
Represented sequence(s):
IPOTF_NSP306
IPOTF_Y22
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AUR62014197-RA | orthology | 0.711 | 4 | - | - |
AUR62024872-RA | orthology | 0.881 | 5 | - | - |
AUR62030676-RA | orthology | 0.852 | 5 | - | - |
Bv2_043150_njdu.t1 | orthology | 0.81 | 4 | - | - |
Bv6_142690_rfcx.t1 | orthology | 1 | 5 | - | - |
Ca_9_830.1 | orthology | 0.749 | 7 | - | - |
Cc11_g08870 | orthology | 0.749 | 7 | - | - |
DCAR_007285 | orthology | 0.696 | 7 | - | - |
DCAR_023613 | orthology | 0.741 | 7 | - | - |
DCAR_026769 | orthology | 0.711 | 7 | - | - |
HanXRQChr08g0212651 | orthology | 0.695 | 5 | - | - |
Oeu036720.1 | orthology | 0.566 | 3 | - | - |
Oeu044351.1 | orthology | 0.549 | 3 | - | - |
PGSC0003DMP400010633 | orthology | 0.489 | 4 | - | - |
Solyc04g007630.1.1 | orthology | 0.483 | 4 | - | - |
capan_pan_p011898 | orthology | 0.489 | 3 | - | - |
capan_pan_p025493 | orthology | 0.43 | 3 | - | - |
capan_pan_p030603 | orthology | 0.498 | 3 | - | - |
itb04g14310.t1 | orthology | 0.0227 | 1 | 290 | 1.09e-102 |