Gene ipotf_pan_p002813
| Sequence ID | ipotf_pan_p002813 add to my list | ||
|---|---|---|---|
| Species | Ipomoea trifida | ||
| Alias | No gene alias | ||
| Pangenome status | Core (2/2) | ||
| Length | 326aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 326 amino acids
>ipotf_pan_p002813_IPOTF MGQKEEAKKEAGEKKGGDAAVKKEEKPTAVVLKADLHCEGCAKKVRRSIRHFDGVEDVKT DWESGKLTVKGNVDPAWLRDILASKIKKKVEILSPQPKKDGGGGAAAGDKKSDDKSAKKD EKDTEKKPKEPQVSTVVLTVRLHCDGCADKVKRVIRKINGVKDVDVDLAKDLVTVKGTMD IKELTAYLREKLKRGVEVVPSKKDGGGGEKKKVDDDGEKKEKKDGEKKEKEGGSESKVEA NKMEYHGHQSNTFYARPMYNQSYYNQDYGLTMSDPSSSSHTGYSSYPYAHAPPPYMHVPP TPPPTYVHAPSPNMFSDEDPNACSVM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
| 3 | GP040674 | Unannotated cluster |
| 4 | GP071484 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for ipotf_pan_p002813
Represented sequence(s):
IPOTF_Y22
IPOTF_NSP306
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Ca_452_22.1 | orthology | 0.662 | 5 | 254 | 1.87e-82 |
| Ca_52_14.1 | orthology | 0.657 | 4 | - | - |
| Ca_7_292.1 | orthology | 0.662 | 5 | - | - |
| Cc06_g04230 | orthology | 0.649 | 5 | 241 | 6.32e-78 |
| DCAR_014996 | orthology | 0.72 | 5 | - | - |
| DCAR_017683 | orthology | 0.705 | 5 | - | - |
| HanXRQChr01g0027741 | orthology | 0.849 | 5 | - | - |
| HanXRQChr13g0401031 | orthology | 0.911 | 5 | - | - |
| HanXRQChr14g0454431 | orthology | 0.787 | 5 | 241 | 4.97e-78 |
| HanXRQChr17g0570331 | orthology | 0.774 | 5 | - | - |
| Oeu005022.1 | orthology | 0.717 | 4 | - | - |
| Oeu016984.1 | orthology | 0.689 | 4 | 262 | 2.85e-86 |
| Oeu019283.1 | orthology | 0.651 | 4 | - | - |
| Oeu045227.1 | orthology | 0.782 | 4 | - | - |
| Oeu061953.1 | orthology | 0.716 | 4 | - | - |
| PGSC0003DMP400006915 | orthology | 0.484 | 4 | 287 | 1.25e-95 |
| Solyc09g008200.2.1 | orthology | 0.523 | 4 | 276 | 3.76e-91 |
| Solyc10g086280.1.1 | orthology | 0.665 | 3 | - | - |
| capan_pan_p000093 | orthology | 0.791 | 3 | - | - |
| capan_pan_p021581 | orthology | 0.544 | 3 | 203 | 1.11e-63 |
| itb15g00310.t1 | orthology | 0.0426 | 1 | 412 | 3.52e-145 |