Gene ipotf_pan_p011082
Sequence ID | ipotf_pan_p011082 add to my list | ||
---|---|---|---|
Species | Ipomoea trifida | ||
Alias | No gene alias | ||
Pangenome status | Core (2/2) | ||
Length | 87aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 87 amino acids
>ipotf_pan_p011082_IPOTF MSQTVVLKVGMSCQGCVGAVNRVLGKMEGVESFDIDMKEQKVTVKGNVKPEDVLQTVSKT GKKTSFWEAEAAAGTETKPNSEAVPTA
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP239638 | Unannotated cluster |
3 | GP341755 | Unannotated cluster |
4 | GP463817 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for ipotf_pan_p011082
Represented sequence(s):
1. | 2. | 3. | |
---|---|---|---|
1. itf00g21800.t1 | 0.00 | 3.51 | -0.00 |
2. itf05g06080.t1 | 3.51 | 0.00 | 3.98 |
3. Itr.xfSc0000258.8 | -0.00 | 3.98 | 0.00 |
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
itb05g05540.t2 | orthology | 0.0307 | 1 | 166 | 1.31e-55 |
sorbi_pan_p029424 | orthology | 0.611 | 2 | - | - |