Gene ipotf_pan_p014346
| Sequence ID | ipotf_pan_p014346 add to my list | ||
|---|---|---|---|
| Species | Ipomoea trifida | ||
| Alias | No gene alias | ||
| Pangenome status | Core (2/2) | ||
| Length | 357aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 357 amino acids
>ipotf_pan_p014346_IPOTF MGEKEETKKDGAENKNEGGDKKGGGDAVPAAAPKAEKKEDGPPPVVLKLDLHCEGCAKKV RRSIRHVEGVEEVKADWESGKVTVKGNVDPKLLLERVAKKTKKQVVLVSPQPKPAAPAAD KKSDDKPEKAEEKKPKEPQVSTVVMKIRLHCDGCAHKIKRIIKKFEGVEDVTVDSQKDLV MAKGTMDAKELTAYLSEKLKRSVEVVPPKKDDGGGAEKKEKDGGREKKEKEGGEKKDKEG GGEKKEKEGDGGEKKKEGEKKADGGGEAAKAVAAEVVNKMEYAGFHPNTYYVTPMYNQSY HNQDYGLMMHHDPSSAQMGYAYAQPYPRVPPPPPPTYINAPPAHMFSDEDPNSCSVM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
| 3 | GP040674 | Unannotated cluster |
| 4 | GP071484 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for ipotf_pan_p014346
Represented sequence(s):
IPOTF_Y22
IPOTF_NSP306
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Ca_452_22.1 | orthology | 0.59 | 5 | - | - |
| Ca_52_14.1 | orthology | 0.585 | 4 | - | - |
| Ca_7_292.1 | orthology | 0.59 | 5 | - | - |
| Cc06_g04230 | orthology | 0.577 | 5 | - | - |
| DCAR_014996 | orthology | 0.648 | 5 | 226 | 5.24e-72 |
| DCAR_017683 | orthology | 0.633 | 5 | - | - |
| HanXRQChr01g0027741 | orthology | 0.776 | 5 | - | - |
| HanXRQChr13g0401031 | orthology | 0.839 | 5 | - | - |
| HanXRQChr14g0454431 | orthology | 0.715 | 5 | - | - |
| HanXRQChr17g0570331 | orthology | 0.702 | 5 | - | - |
| Oeu005022.1 | orthology | 0.644 | 4 | - | - |
| Oeu016984.1 | orthology | 0.617 | 4 | - | - |
| Oeu019283.1 | orthology | 0.579 | 4 | - | - |
| Oeu045227.1 | orthology | 0.709 | 4 | - | - |
| Oeu061953.1 | orthology | 0.643 | 4 | - | - |
| PGSC0003DMP400006915 | orthology | 0.411 | 4 | - | - |
| Solyc09g008200.2.1 | orthology | 0.451 | 4 | - | - |
| Solyc10g086280.1.1 | orthology | 0.593 | 3 | - | - |
| capan_pan_p000093 | orthology | 0.718 | 3 | 188 | 3.48e-57 |
| capan_pan_p021581 | orthology | 0.472 | 3 | - | - |
| itb06g04100.t1 | orthology | 0.0103 | 1 | 506 | 1.87e-181 |