Gene ipotf_pan_p019855
| Sequence ID | ipotf_pan_p019855 add to my list | ||
|---|---|---|---|
| Species | Ipomoea trifida | ||
| Alias | No gene alias | ||
| Pangenome status | Core (2/2) | ||
| Length | 140aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 140 amino acids
>ipotf_pan_p019855_IPOTF MSMVEVRVPNLDCEGCAAKLRKALFKLKGVDDIDIEMETQKITVRGYGLEEKKVVRAIKR AGKAAEPWPYPVGYSHLASFYQYPNHIAAGYYDSISSRNVAAPSVHTFFHTPAVYSVAVA PDEAVASLFSDDNPHACAIM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for ipotf_pan_p019855
Represented sequence(s):
IPOTF_Y22
IPOTF_NSP306
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT3G48970.1 | orthology | 0.519 | 10 | 196 | 6.37e-66 |
| AUR62015981-RA | orthology | 0.472 | 9 | - | - |
| Bv3_055490_mxet.t1 | orthology | 0.505 | 9 | 208 | 9.23e-71 |
| Ca_8_1007.1 | orthology | 0.225 | 4 | 236 | 2.38e-81 |
| Cc02_g02970 | orthology | 0.225 | 4 | 233 | 1.77e-80 |
| Cg9g026790.1 | orthology | 0.319 | 10 | 212 | 3.15e-72 |
| Cm028340.1 | orthology | 0.319 | 10 | 212 | 5.3e-72 |
| Cs9g17280.1 | orthology | 0.319 | 10 | 212 | 3.43e-72 |
| DCAR_009368 | orthology | 0.326 | 8 | 222 | 4.34e-76 |
| FvH4_7g29520.1 | orthology | 0.358 | 11 | 208 | 1.13e-70 |
| HanXRQChr06g0183831 | orthology | 0.396 | 5 | 207 | 6.37e-70 |
| HanXRQChr09g0253621 | orthology | 0.423 | 5 | - | - |
| MELO3C003319.2.1 | orthology | 0.455 | 9 | 189 | 7.76e-63 |
| Manes.14G025900.1 | orthology | 0.392 | 11 | 223 | 9.78e-77 |
| Mba01_g04690.1 | orthology | 0.575 | 8 | 184 | 2.58e-61 |
| Oeu024220.1 | orthology | 0.222 | 5 | 225 | 3.27e-77 |
| PGSC0003DMP400025270 | orthology | 0.137 | 4 | 247 | 3.69e-86 |
| Solyc03g025790.2.1 | orthology | 0.127 | 4 | 251 | 1.56e-87 |
| brana_pan_p044950 | orthology | 0.492 | 11 | 199 | 7.08e-67 |
| braol_pan_p025375 | orthology | 0.492 | 12 | 200 | 3.4e-67 |
| brarr_pan_p005835 | orthology | 0.492 | 12 | 200 | 3.03e-67 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_41314.1 | orthology | 0.368 | 12 | 216 | 7.36e-74 |
| capan_pan_p012989 | orthology | 0.15 | 3 | 250 | 3.37e-87 |
| cucsa_pan_p007884 | orthology | 0.422 | 9 | 191 | 2.04e-63 |
| evm_27.model.AmTr_v1.0_scaffold00076.26 | orthology | 0.539 | 6 | 185 | 8.03e-62 |
| itb03g13280.t1 | orthology | 0 | 1 | 285 | 4.72e-101 |
| maldo_pan_p005834 | orthology | 0.364 | 11 | 214 | 6.72e-73 |
| maldo_pan_p046866 | orthology | 0.789 | 11 | - | - |
| medtr_pan_p031372 | orthology | 0.351 | 10 | 214 | 5.61e-73 |
| musac_pan_p029616 | orthology | 0.562 | 8 | 186 | 7e-62 |
| phavu.G19833.gnm2.ann1.Phvul.004G116300.1 | orthology | 0.366 | 12 | 213 | 1.26e-72 |
| soybn_pan_p030070 | orthology | 0.342 | 11 | 182 | 1.05e-60 |
| thecc_pan_p002573 | orthology | 0.339 | 11 | 215 | 2.02e-73 |
| vitvi_pan_p028565 | orthology | 0.285 | 6 | 207 | 1.75e-70 |