Gene ipotf_pan_p021052
Sequence ID | ipotf_pan_p021052 add to my list | ||
---|---|---|---|
Species | Ipomoea trifida | ||
Alias | No gene alias | ||
Pangenome status | Dispensable (1/2) | ||
Length | 159aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 159 amino acids
>ipotf_pan_p021052_IPOTF MEPKAEADCVLKVDVQCDECKMKLMEVLSSISGVYSVTIDAEQGIAKVAGEVEPNALLRA LSRSGKHAELVRVTFRDPRMTRYSNYDRYASSPPPYTQQGYGNGYNAIEDSCARELPEHS LGYDYPDNNYSGGYLPPAQYLPSFDEYKDADSTSLCAIM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP241299 | Unannotated cluster |
3 | GP344409 | Unannotated cluster |
4 | GP489165 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for ipotf_pan_p021052
Represented sequence(s):
Unrepresented genome(s):
IPOTF_NSP306
IPOTF_Y22
1. | 2. | 3. | 4. | 5. | 6. | |
---|---|---|---|---|---|---|
1. itf02g27750.t1 | 0.00 | 7.86 | 3.20 | 7.18 | 7.16 | 13.19 |
2. itf02g24490.t1 | 7.86 | 0.00 | 4.51 | 5.17 | 13.30 | 11.54 |
3. itf02g24510.t1 | 3.20 | 4.51 | 0.00 | 5.17 | 7.91 | 10.73 |
4. itf02g27270.t1 | 7.18 | 5.17 | 5.17 | 0.00 | 12.51 | 9.92 |
5. itf02g24500.t1 | 7.16 | 13.30 | 7.91 | 12.51 | 0.00 | 15.73 |
6. itf02g24560.t1 | 13.19 | 11.54 | 10.73 | 9.92 | 15.73 | 0.00 |
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Oeu049387.1 | orthology | 1 | 3 | - | - |
PGSC0003DMP400038366 | orthology | 1 | 5 | - | - |
Solyc07g065430.2.1 | orthology | 1 | 5 | - | - |
capan_pan_p030197 | orthology | 1 | 4 | - | - |
itb02g23000.t1 | orthology | 0.214 | 1 | - | - |