Gene ipotf_pan_p021052


Sequence ID ipotf_pan_p021052  add to my list
Species Ipomoea trifida
Alias No gene alias
Pangenome status Dispensable (1/2)
Length 159aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 159 amino acids

>ipotf_pan_p021052_IPOTF
MEPKAEADCVLKVDVQCDECKMKLMEVLSSISGVYSVTIDAEQGIAKVAGEVEPNALLRA
LSRSGKHAELVRVTFRDPRMTRYSNYDRYASSPPPYTQQGYGNGYNAIEDSCARELPEHS
LGYDYPDNNYSGGYLPPAQYLPSFDEYKDADSTSLCAIM





Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323
Heavy metal transport/detoxification protein superfamily
2 GP241299 Unannotated cluster
3 GP344409 Unannotated cluster
4 GP489165 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121
Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163
Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for ipotf_pan_p021052



Represented sequence(s):
IPOTF_NSP306
Unrepresented genome(s):
IPOTF_Y22

  1. 2. 3. 4. 5. 6.
1. itf02g27750.t1 0.00 7.86 3.20 7.18 7.16 13.19
2. itf02g24490.t1 7.86 0.00 4.51 5.17 13.30 11.54
3. itf02g24510.t1 3.20 4.51 0.00 5.17 7.91 10.73
4. itf02g27270.t1 7.18 5.17 5.17 0.00 12.51 9.92
5. itf02g24500.t1 7.16 13.30 7.91 12.51 0.00 15.73
6. itf02g24560.t1 13.19 11.54 10.73 9.92 15.73 0.00


Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Oeu049387.1 orthology 1 3 - -
PGSC0003DMP400038366 orthology 1 5 - -
Solyc07g065430.2.1 orthology 1 5 - -
capan_pan_p030197 orthology 1 4 - -
itb02g23000.t1 orthology 0.214 1 - -