Gene ipotf_pan_p023152
Sequence ID | ipotf_pan_p023152 add to my list | ||
---|---|---|---|
Species | Ipomoea trifida | ||
Alias | No gene alias | ||
Pangenome status | Dispensable (1/2) | ||
Length | 248aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 248 amino acids
>ipotf_pan_p023152_IPOTF MQKPRITEVQVRMDCNGCVQKIKKALHGVNGIYEVYIDFPDQKITIVGRADPEKIVKAIK KTRKSAVICSHTEQQPNPSEQPPDEAAEEETAKAKDPPPVAPENQPTADEEKHSPETAEI QTADQTSKPKEDNNNVEEVVHHVIYHYPPHYYGYTQQWNNSQPRAEPPPLPPIYVSHSYN SYKPSPHVTRYDHSSSPSTYTHYGRSDEHYYTRMAAEDYYHYTDDYHNGNSDDSVFSEEE NPNSCTIV
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP047778 | Unannotated cluster |
4 | GP077656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for ipotf_pan_p023152
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
PGSC0003DMP400011064 | orthology | 0.79 | 4 | - | - |
Solyc01g065690.2.1 | orthology | 0.809 | 4 | - | - |
capan_pan_p001422 | orthology | 0.788 | 3 | 156 | 5.38e-46 |
ipotf_pan_p022606 | ultra-paralogy | 0.0518 | 0 | - | - |
itb04g19450.t2 | orthology | 0.479 | 1 | - | - |