Gene ipotf_pan_p026205


Sequence ID ipotf_pan_p026205  add to my list
Species Ipomoea trifida
Alias No gene alias
Pangenome status Dispensable (1/2)
Length 148aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 148 amino acids

>ipotf_pan_p026205_IPOTF
MGFLNNLFDMFEISTNKSRNKHKNLQTVEIKVKMDCDGCERRVKNAVSLLKAGVKTVEVN
RKQSRLIVTGFVEPKRVLEKVRSTGKRAEFWPYVKVDLVSYPYVAGAYDKKAPSGYVRNV
PHAVNPTPDTERFISMFSDDNPNACSIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP463678 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for ipotf_pan_p026205



Represented sequence(s):
IPOTF_NSP306
itf14g00980.t2
Unrepresented genome(s):
IPOTF_Y22


Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
AUR62014197-RA orthology 0.716 4 - -
AUR62024872-RA orthology 0.886 5 - -
AUR62030676-RA orthology 0.857 5 - -
Bv2_043150_njdu.t1 orthology 0.815 4 - -
Bv6_142690_rfcx.t1 orthology 1 5 - -
Ca_9_830.1 orthology 0.754 7 - -
Cc11_g08870 orthology 0.754 7 - -
DCAR_007285 orthology 0.701 7 - -
DCAR_023613 orthology 0.746 7 - -
DCAR_026769 orthology 0.716 7 - -
HanXRQChr08g0212651 orthology 0.7 5 - -
Oeu036720.1 orthology 0.571 3 - -
Oeu044351.1 orthology 0.554 3 - -
PGSC0003DMP400010633 orthology 0.494 4 - -
Solyc04g007630.1.1 orthology 0.488 4 - -
capan_pan_p011898 orthology 0.494 3 - -
capan_pan_p025493 orthology 0.435 3 - -
capan_pan_p030603 orthology 0.503 3 - -
itb14g01060.t2 orthology 0 1 298 3.95e-106