Gene ipotf_pan_p029827
Sequence ID | ipotf_pan_p029827 add to my list |
---|---|
Species | Ipomoea trifida |
Alias | No gene alias |
Pangenome status | Dispensable (1/2) |
Length | 110aa |
Length: 110 amino acids
>ipotf_pan_p029827_IPOTF MSNQLVITTCFRRQFGGATLMVQRLGLHHVSIKYQLNPFECCVFVDEKQKELEKHLIEQK HSRVSVCGRFVPQDVAIQIRKRTNRRVEILDVQEFNEIPEHKQPPLFITS
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP109350 | Unannotated cluster |
3 | GP119142 | Unannotated cluster |
4 | GP077996 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.