Gene itb02g05420.t1


Sequence ID itb02g05420.t1  add to my list
Species Ipomoea triloba
Alias No gene alias
Length 256aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 256 amino acids

>itb02g05420.t1_IPOTR
MSLSLVAPTTFALKLKIHCNGCEKKLKQMLLKVQGVHSVRVDAKQGHVLITGTVDPPTIL
TMLEKLGRKAELLWEQGSPASPTTIRDRGKDVEIVTRSLKGIKPLMSYQDIMENPGQLSE
IPGLQTVEVTSTIKFGFKNGSVAEISSARDDAKPLVLPPPSPGHHGCFHGNGYFESCGMN
SHNNCCHWHSPGVAFGRNVSPPGPAPPWQFGFPSAPPVPSDYEPSTPSQPPQPAPVRANT
YPSMFSDENPNSCTIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP489122 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for itb02g05420.t1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Ca_25_98.1 orthology 0.907 4 146 8.9e-35
Ca_63_138.6 orthology 0.907 4 - -
Ca_78_564.2 orthology 0.965 4 - -
Cc02_g07920 orthology 0.912 4 146 3e-35
PGSC0003DMP400024192 orthology 0.845 3 144.4 1e-34
PGSC0003DMP400040733 orthology 0.768 2 - -
capan_pan_p030739 orthology 0.839 3 - -
capan_pan_p038035 orthology 0.848 3 150 1.49e-44
capan_pan_p041830 orthology 0.845 3 - -
ipotf_pan_p023915 orthology 0.0385 1 466 1.2e-168