Gene itb02g08570.t1


Sequence ID itb02g08570.t1  add to my list
Species Ipomoea triloba
Alias No gene alias
Length 152aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 152 amino acids

>itb02g08570.t1_IPOTR
MTVIEMRVHMDCGGCESKIRKALQKLKGVDEVDIDMTMQKVTVTGWADQKKVLKTVRKTG
RRAEIWQFPFNNPEMVNHNNHVAGYYPQQSYGGPATFHCTSQPPSSSYNYYKHGYDNFDR
SFRLGRGNSGNIFGSRIGGTFSDENPHSCSIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP078604 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for itb02g08570.t1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Cc05_g08310 orthology 0.562 4 177.6 5.5e-45
Oeu042935.1 orthology 0.47 3 196.1 2.6e-50
PGSC0003DMP400035470 orthology 0.393 4 152.9 1.7e-37
Solyc07g055010.2.1 orthology 0.404 4 208.4 3.4e-54
capan_pan_p019104 orthology 0.397 3 210 5.57e-71
ipotf_pan_p020842 orthology 0.0069 1 311 4e-111