Gene itb02g23000.t1
| Sequence ID | itb02g23000.t1 add to my list |
|---|---|
| Species | Ipomoea triloba |
| Alias | No gene alias |
| Length | 117aa |
Length: 117 amino acids
>itb02g23000.t1_IPOTR MLNKGSQKVAGEVEPNALLRALSKSGKHAQLKRVTFRDPRMTCYNNYDRYASPSPPYTRQ GYDNRYNAIEDSYARDLHEHSLGYDTNYSGGYLALAQYLPIVDEYKDAGSTSLCTIM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP241299 | Unannotated cluster |
| 3 | GP344409 | Unannotated cluster |
| 4 | GP489165 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Oeu049387.1 | orthology | 1 | 3 | - | - |
| PGSC0003DMP400038366 | orthology | 1 | 5 | - | - |
| Solyc07g065430.2.1 | orthology | 1 | 5 | - | - |
| capan_pan_p030197 | orthology | 1 | 4 | - | - |
| ipotf_pan_p021052 | orthology | 0.214 | 1 | - | - |