Gene itb03g13280.t1


Sequence ID itb03g13280.t1  add to my list
Species Ipomoea triloba
Alias No gene alias
Length 140aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 140 amino acids

>itb03g13280.t1_IPOTR
MSMVEVRVPNLDCEGCAAKLRKALFKLKGVDDIDIEMETQKITVRGYGLEEKKVVRAIKR
AGKAAEPWPYPVGYSHLASFYQYPNHIAAGYYDSISSRNVAAPSVHTFFHTPAVYSVAVA
PDEAVASLFSDDNPHACAIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP078604 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for itb03g13280.t1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
AT3G48970.1 orthology 0.519 10 196.1 1.5e-50
AUR62015981-RA orthology 0.472 9 - -
Bv3_055490_mxet.t1 orthology 0.505 9 208 3.6e-54
Ca_8_1007.1 orthology 0.225 4 236.5 2.8e-62
Cc02_g02970 orthology 0.225 4 233 1e-61
Cg9g026790.1 orthology 0.319 10 212.6 1.5e-55
Cm028340.1 orthology 0.319 10 212.6 2.5e-55
Cs9g17280.1 orthology 0.319 10 212.6 1.6e-55
DCAR_009368 orthology 0.326 8 222.2 2.2e-58
FvH4_7g29520.1 orthology 0.358 11 208 3.9e-54
HanXRQChr06g0183831 orthology 0.396 5 206.8 1.4e-53
HanXRQChr09g0253621 orthology 0.423 5 - -
MELO3C003319.2.1 orthology 0.455 9 188 3.6e-48
Manes.14G025900.1 orthology 0.392 11 223.8 7.8e-59
Mba01_g04690.1 orthology 0.575 8 185.3 3e-47
Oeu024220.1 orthology 0.222 5 224.9 4.8e-59
PGSC0003DMP400025270 orthology 0.137 4 247.7 4.7e-66
Solyc03g025790.2.1 orthology 0.127 4 251.1 4.3e-67
brana_pan_p044950 orthology 0.492 11 200 2.57e-67
braol_pan_p025375 orthology 0.492 12 201 1.23e-67
brarr_pan_p005835 orthology 0.492 12 201 1.1e-67
cajca.ICPL87119.gnm1.ann1.C.cajan_41314.1 orthology 0.368 12 216.1 1.6e-56
capan_pan_p012989 orthology 0.15 3 251 1.22e-87
cucsa_pan_p007884 orthology 0.422 9 192 7.43e-64
evm_27.model.AmTr_v1.0_scaffold00076.26 orthology 0.539 6 186 1.2e-47
ipotf_pan_p019855 orthology 0 1 286 1.58e-101
maldo_pan_p005834 orthology 0.364 11 215 2.44e-73
maldo_pan_p046866 orthology 0.789 11 - -
medtr_pan_p031372 orthology 0.351 10 215 2.04e-73
musac_pan_p029616 orthology 0.562 8 187 2.54e-62
phavu.G19833.gnm2.ann1.Phvul.004G116300.1 orthology 0.366 12 213.4 9.4e-56
soybn_pan_p030070 orthology 0.342 11 184 3.81e-61
thecc_pan_p002573 orthology 0.339 11 216 7.35e-74
vitvi_pan_p028565 orthology 0.285 6 209 6.37e-71