Gene itb03g16430.t1
Sequence ID | itb03g16430.t1 add to my list | ||
---|---|---|---|
Species | Ipomoea triloba | ||
Alias | No gene alias | ||
Length | 225aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 225 amino acids
>itb03g16430.t1_IPOTR MSSLPPEQTIILQLKIHSKDSERRIKKWMLGIQGVRRVDFDAERGVTIVSGTIDPPKLLM MLENYGVKAEIFGPRRRPVSPVSIISSPLLDPEISALLKSLPKNSAGPKTVEVTKTVRFY FRDGENGGRGNKTGVDHGGGLCGCSRRNGNFSGGNYFPTSGPQPGNLGFDPLGAPLWVAA GVPSAPPLPEGDNSPLPPPPPPPPGTNPFYTVFSDDNTSSSCTIM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP243330 | Unannotated cluster |
3 | GP372685 | Unannotated cluster |
4 | GP517386 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for itb03g16430.t1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
ipotf_pan_p028509 | orthology | 0.109 | 1 | 325 | 2.43e-114 |