Gene itb04g14310.t1


Sequence ID itb04g14310.t1  add to my list
Species Ipomoea triloba
Alias No gene alias
Length 146aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 146 amino acids

>itb04g14310.t1_IPOTR
MGFVDHLSDKFEVTSTRKSSRKAMQTVEIMVEMDCDGCEKRVRKAVSSIKGAESVEIDRN
ESRVTVKGYVEPNKVLRKVQRTGKSAEFWPYVRYDLVAYPYAHEAYDEVAPQGYVRNVPQ
ALLPNPTTERFTTMFSDENPNACSIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP463617 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for itb04g14310.t1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
AUR62014197-RA orthology 0.689 4 - -
AUR62024872-RA orthology 0.859 5 - -
AUR62030676-RA orthology 0.831 5 - -
Bv2_043150_njdu.t1 orthology 0.789 4 - -
Bv6_142690_rfcx.t1 orthology 1 5 - -
Ca_9_830.1 orthology 0.728 7 - -
Cc11_g08870 orthology 0.728 7 - -
DCAR_007285 orthology 0.675 7 - -
DCAR_023613 orthology 0.719 7 - -
DCAR_026769 orthology 0.69 7 - -
HanXRQChr08g0212651 orthology 0.673 5 - -
Oeu036720.1 orthology 0.545 3 - -
Oeu044351.1 orthology 0.527 3 - -
PGSC0003DMP400010633 orthology 0.468 4 - -
Solyc04g007630.1.1 orthology 0.461 4 - -
capan_pan_p011898 orthology 0.467 3 - -
capan_pan_p025493 orthology 0.409 3 - -
capan_pan_p030603 orthology 0.477 3 - -
ipotf_pan_p001332 orthology 0.0227 1 288 3.02e-102