Gene itb04g19450.t2
| Sequence ID | itb04g19450.t2 add to my list | ||
|---|---|---|---|
| Species | Ipomoea triloba | ||
| Alias | No gene alias | ||
| Length | 164aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 164 amino acids
>itb04g19450.t2_IPOTR MPKIDSPFNSYTLLQSGLRAPLCSDLSPFLSAIMATELEKPRITEVQVRMDCNGCVQKIK KALHGINGIYEVYIDFPDQKITIVGRADPEKIVKAIKKSRKSAVICCHTEQQPNHLMRRQ PKPKILLRWPLKTNQQQMRRNTHLKCKQQTKPQSQRRIIIMLKR
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP047778 | Unannotated cluster |
| 4 | GP077656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for itb04g19450.t2
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| PGSC0003DMP400011064 | orthology | 1 | 4 | - | - |
| Solyc01g065690.2.1 | orthology | 1 | 4 | - | - |
| capan_pan_p001422 | orthology | 1 | 3 | - | - |
| ipotf_pan_p022606 | orthology | 0.499 | 1 | 179 | 8.4e-57 |
| ipotf_pan_p023152 | orthology | 0.479 | 1 | - | - |