Gene itb05g05540.t2
Sequence ID | itb05g05540.t2 add to my list | ||
---|---|---|---|
Species | Ipomoea triloba | ||
Alias | No gene alias | ||
Length | 87aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 87 amino acids
>itb05g05540.t2_IPOTR MSQTVVLKVGMSCQGCVGAVNRVLGKMEGVESFDIDLKEQKVTVKGNVKPEDVLQTVSKT GKKTSFWEAEAPAGTETKPNSEAVPTA
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP239638 | Unannotated cluster |
3 | GP341755 | Unannotated cluster |
4 | GP463817 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for itb05g05540.t2
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
ipotf_pan_p011082 | orthology | 0.0307 | 1 | 168 | 1.53e-56 |
sorbi_pan_p029424 | orthology | 0.611 | 2 | - | - |