Gene itb11g13550.t1
Sequence ID | itb11g13550.t1 add to my list | ||
---|---|---|---|
Species | Ipomoea triloba | ||
Alias | No gene alias | ||
Length | 327aa | ||
Gene Ontology |
![]()
|
Length: 327 amino acids
>itb11g13550.t1_IPOTR MGEEEKKAAEKKEDPPSAAGGDEKKAEGEAKPAEESKDAPPPPPPPQEIVLRVFMHCEGC ARKVRRCLKDFDGVEDVVTDCKTHKVVVKGEKADPVKVLERVQKKSHRQVELLSPIPAPA PEEEHKKPPEEVAKPEEKKEEPQVITVVLKAHMHCEACAEAIKKRILRMKGVENVEPDFK GSQVTVRGVFDPQNLVDYVAKKTGKRAVVVKVEPKKDEAAGEKAKEGKEEKKAEEGKKGG DGDGGEKKEGESGGGEKKEGDGEGVELAEDPKMEMKKHELYYSYYPPIQVNNPNYHHQRF VAAQDGGYGYGYPQMFSDENPNACSVM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP040674 | Unannotated cluster |
4 | GP070448 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for itb11g13550.t1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
PGSC0003DMP400045992 | orthology | 0.444 | 4 | 230.7 | 1.4e-60 |
PGSC0003DMP400046761 | orthology | 0.496 | 4 | - | - |
Solyc03g097380.2.1 | orthology | 0.448 | 4 | 270 | 1.82e-89 |
Solyc06g072700.2.1 | orthology | 0.483 | 4 | 221.5 | 8.4e-58 |
capan_pan_p009765 | orthology | 0.499 | 3 | - | - |
capan_pan_p023481 | orthology | 0.433 | 3 | 249 | 1.59e-81 |
capan_pan_p035442 | orthology | 0.53 | 3 | - | - |
ipotf_pan_p015819 | orthology | 0.0472 | 1 | 412 | 4.47e-145 |