Gene itb12g00660.t1


Sequence ID itb12g00660.t1  add to my list
Species Ipomoea triloba
Alias No gene alias
Length 153aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 153 amino acids

>itb12g00660.t1_IPOTR
MGLGGTLEYISDMMSSSHSHKHKKKKKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV
DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV
RRVDNPTTGTATRFDDPYVTIFSDENPNACSVM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP463617 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for itb12g00660.t1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
PGSC0003DMP400037825 orthology 0.253 4 - -
Solyc05g051820.2.1 orthology 0.246 4 - -
capan_pan_p020108 orthology 0.181 3 241 3.14e-83
ipotf_pan_p006080 orthology 0.0136 1 276 2.73e-97